中文English Call: 400-669-8850 | E-mail: biotyscience@gmail.com

Polyclonal Antibody

Location:Home >>Products >>Antibodies >>Primary Antibodies >>Polyclonal Antibody

Contact us

Biotyscience Inc

E-mail biotyscience@gmail.com 

            info@biotyscience.com

Tel 400-669-8850


Rabbit Anti-PPARγ Polyclonal Antibody

Cat NoBSPA-0429
Conjugate
TypePolyclonal Antibody
SourceRabbit
Size50 ul
ApplicationWB, IF, IHC
FormatLiquid
ConcentrationPlease refer to the vial lable for the specific concentration.
BufferSupplied in PBS.
StorageStore at -20 degree. Avoid repeated freeze/thaw cycles.
SynonymsPPARG;CIMT1;GLM1;NR1C3;PPARG1;PPARG2;PPARgamma;peroxisome proliferator-activated receptor gamma
PurificationAffinity purification
NoteThis product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications.
MolecularWeight
DescriptionSequence: LSVMEDHSHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAIKVEPASPPYYSEKTQLYNKPHEEPSNSLMAIECRVCGDKASGFH
BackgroundPeroxisome proliferator-activated receptor γ (PPARγ) is a member of the ligand-activated nuclear receptor superfamily and functions as a transcriptional activator. PPARγ is preferentially expressed in adipocytes as well as in vascular smooth muscle cells and macrophage. Besides its role in mediating adipogenesis and lipid metabolism, PPARγ also modulates insulin sensitivity, cell proliferation and inflammation. PPARγ transcriptional activity is inhibited by MAP kinase phosphorylation of PPARγ at Ser84.
We can offer labeled proteins/antibodies using a broad range of intensely fluorescent dyes and labels including FITC, Biotin, Alexa Fluor, Rhodamine B, Cy, Co-Au.